SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g30340

Feature Type:gene_model
Chromosome:Gm10
Start:39011407
stop:39013774
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma10g30340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14746AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: EGF-like (InterPro:IPR006210); Has 259 Blast hits to 234 proteins in 55 species: Archae - 0; Bacteria - 0; Metazoa - 184; Fungi - 0; Plants - 69; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr4:8462720-8464326 REVERSE LENGTH=212 SoyBaseE_val: 6.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
UniRef100_C6T2H8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2H8_SOYBN SoyBaseE_val: 4.00E-150ISS
UniRef100_G7L1U2UniRef Annotation by Michelle Graham. Most informative UniRef hit: MtN26 protein n=1 Tax=Medicago truncatula RepID=G7L1U2_MEDTR SoyBaseE_val: 9.00E-57ISS

Expression Patterns of Glyma10g30340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma10g30340
ParalogEvidenceComments
Glyma20g36700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma10g30340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g161500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma10g30340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma10g30340
>Glyma10g30340.1   sequence type=CDS   gene model=Glyma10g30340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTCCTCCAAGTTATTGGGTATTATGGCCATGCTTTTCATAGTGCTTCTACCCATGGCTGCCAAAGGGGATAATATTACTGATTTCTTTGATAAGGTTTGTGAAGAAGTGGAATGTGGTAAGGGAAGCTGCGTAGTAAACACAAGTTACCCATTAAACTTCGTTTGTGAATGCGATTCTGGCTGGAAGCGAACCCAAGATGACGATGATGAATATGCCACTAGCTTTCTTCCATGTGTCATTCCCGAATGTAGCTTGAACTATGGTTGTCAGCCAGCACCACCGCCAGTTCCAGAGAAGAGTTTTCCACATAACTTCTCAGCTTTTGATCCTTGCTATTGGGCGTACTGTGGGGAAGGTACATGCACCAAGAACAGAACACATACACACAGATGCGAATGCCAACCCAATTACTATAATCTTCTCAACATCTCAGTTTTTCCTTGTTACAGTGAATGTACTCTTGGATCTGATTGTTCGAGACTCGGAATCAAAGTTGCAAATTCATCCACTGATAGTGGCAGTCAAGATAGCTCAGCCTCAATCTTCACAGGAAGGTTTCATTGGATGGTTATGTTGTTGATGTCCACGGGTATGGTTATGTGGAGCTAG
Predicted protein sequences of Glyma10g30340
>Glyma10g30340.1   sequence type=predicted peptide   gene model=Glyma10g30340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSSKLLGIMAMLFIVLLPMAAKGDNITDFFDKVCEEVECGKGSCVVNTSYPLNFVCECDSGWKRTQDDDDEYATSFLPCVIPECSLNYGCQPAPPPVPEKSFPHNFSAFDPCYWAYCGEGTCTKNRTHTHRCECQPNYYNLLNISVFPCYSECTLGSDCSRLGIKVANSSTDSGSQDSSASIFTGRFHWMVMLLMSTGMVMWS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo